A novel human metalloprotease synthesized in the liver and secreted into the blood: possibly, the von Willebrand factor-cleaving protease?

J Biochem. 2001 Oct;130(4):475-80. doi: 10.1093/oxfordjournals.jbchem.a003009.

Abstract

We identified a novel metalloprotease, which could be responsible for cleaving the Tyr842-Met843 peptide bond of von Willebrand factor (vWF). This metalloprotease was purified from Cohn Fraction-I precipitate of human pooled plasma by the combination of gel filtration, DEAE chromatography, and preparative polyacrylamide gel electrophoresis in the presence of SDS. The NH2-terminal amino acid sequence of the isolated protein was: AAGGILHLELLVAVGPDVFQAHQEDTRRY. Based on this sequence, we searched human genomic and EST databases, and identified compatible nucleotide sequences. These results suggested that this protein is a novel metalloprotease, a member of the family of a disintegrin and metalloprotease with thrombospondin type-1 motifs (ADAMTS), and its genomic DNA was mapped to human chromosome 9q34. Multiple human tissue northern blotting analysis indicated that the mRNA encoding this protease spanned approximately 5 kilobases and was uniquely expressed in the liver. Furthermore, we determined the cDNA sequence encoding this protease, and found that this protease was comprised of a signal peptide, a proregion followed by the putative furin cleavage site, a reprolysin-type zinc-metalloprotease domain, a disintegrin-like domain, a thrombospondin type-1 (TSP1) motif, a cysteine-rich region, a spacer domain, and COOH-terminal TSP1 motif repeats.

MeSH terms

  • ADAM Proteins
  • ADAMTS13 Protein
  • Alternative Splicing
  • Amino Acid Motifs
  • Amino Acid Sequence
  • Base Sequence
  • Chromosome Mapping
  • Cloning, Molecular
  • Disintegrins / chemistry
  • Humans
  • Liver / enzymology*
  • Metalloendopeptidases / biosynthesis*
  • Metalloendopeptidases / genetics
  • Metalloendopeptidases / metabolism
  • Molecular Sequence Data
  • Protein Isoforms / genetics
  • Protein Structure, Tertiary
  • RNA, Messenger / biosynthesis
  • Thrombospondin 1 / chemistry
  • Tissue Distribution
  • Transcription, Genetic
  • von Willebrand Factor / metabolism*

Substances

  • Disintegrins
  • Protein Isoforms
  • RNA, Messenger
  • Thrombospondin 1
  • von Willebrand Factor
  • ADAM Proteins
  • Metalloendopeptidases
  • ADAMTS13 Protein
  • ADAMTS13 protein, human

Associated data

  • GENBANK/AB069698